McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF572-4:1

Chromosome

chr8

Gene Name

lnc-ZNF572-4

Start

124815058

CPC Label

noncoding

End

124816730

Cancer

PRAD

Strand

+

Peptide

LQSPCSQPLHSTTFQLGMHAMFMFLK

Modified Peptide

LQSPCSQPLHSTTFQLGM[147]HAM[147]FM[147]FLK

Peptide Length

26

ORF Length

74

Open Reading Frame (ORF)

LWKKVPGHRARELGRWGCHTVRLQSPCSQPLHSTTFQLGMHAMFMFLKREHGCLKVENSSNRHEQISVLSLAIP

Conservation Score

0.96

PhyloCSF Frame 1

-4.211

No. of Spectra

64

CPC Coding Probability

0.0498519

PhyloCSF Frame 2 

-5.006

CNTI Index

noncoding

Max Probability

0.9766

PhyloCSF Frame 3

-2.712

CNTI Score

-0.370780403