McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF572-3:1

Chromosome

chr8

Gene Name

lnc-ZNF572-3

Start

125012450

CPC Label

noncoding

End

125020276

Cancer

EOGC

Strand

+

Peptide

SFIVLPLK

Modified Peptide

n[145]SFIVLPLK

Peptide Length

8

ORF Length

148

Open Reading Frame (ORF)

LSPRLECDGAISAHCNLGLPGSSNSPASASRVAGIIGARHRAQLIFVFLVETGFRHVGQAGLKLLTSGDPPTSASQSPGITGMSHHAWPVTPIFSSKSFIVLPLKFSSLIHFELNFVSVERKGSSLICLCVDIQLSQYHLLKRLFVPQ

Conservation Score

0.767

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0467495

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3952

PhyloCSF Frame 3

0

CNTI Score

-0.372821415