McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF571-1:5

Chromosome

chr19

Gene Name

lnc-ZNF571-1

Start

37547827

CPC Label

coding

End

37551069

Cancer

OV

Strand

-

Peptide

IFGILRDHVVLP

Modified Peptide

n[145]IFGILRDHVVLP

Peptide Length

12

ORF Length

146

Open Reading Frame (ORF)

LRVAASPPLHRGFRNQERNKERLPRNPSPAKETGASERRRTTEKPRFTARATFLSPHTTHTLTRTHRKTHGNIQQSHRNTHSQAAPEAARFCSLPGNPSGKRAPRGTQAGRTSKSQRGHLSGRRTLTPPMHARRIFGILRDHVVLP

Conservation Score

0.12

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.997007

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7645

PhyloCSF Frame 3

0

CNTI Score

-0.338274338