McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF536-8:2

Chromosome

chr19

Gene Name

lnc-ZNF536-8

Start

31350045

CPC Label

coding

End

31374019

Cancer

BRCA-Luminal B

Strand

+

Peptide

HQVGALLPALTWNAGIWVFR

Modified Peptide

n[145]HQVGALLPALTWNAGIWVFR

Peptide Length

20

ORF Length

60

Open Reading Frame (ORF)

LYPLSKCEGICPRCRLLGSPGLGSTRGERHQVGALLPALTWNAGIWVFRLPHASPHHILG

Conservation Score

0.008

PhyloCSF Frame 1

0

No. of Spectra

22

CPC Coding Probability

0.51404

PhyloCSF Frame 2 

-4.455

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

0

CNTI Score

-0.276681645