McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF534-1:2

Chromosome

chr19

Gene Name

lnc-ZNF534-1

Start

52453581

CPC Label

noncoding

End

52458836

Cancer

EOGC

Strand

+

Peptide

TIDLFFPPLK

Modified Peptide

n[145]TIDLFFPPLK

Peptide Length

10

ORF Length

72

Open Reading Frame (ORF)

LAFDTQCFSVPNCTRWKMCSSRGKTIDLFFPPLKLNTVVNTEPRILHLWSPNVWGFLPTNKQFSIRHQLGVP

Conservation Score

0.461

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0938092

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9992

PhyloCSF Frame 3

0

CNTI Score

-0.353028723