McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF517-3:1

Chromosome

chr8

Gene Name

lnc-ZNF517-3

Start

144792563

CPC Label

noncoding

End

144796174

Cancer

CCRC

Strand

+

Peptide

RWAGETR

Modified Peptide

n[230]RWAGETR

Peptide Length

7

ORF Length

103

Open Reading Frame (ORF)

LKVSWCAWARKEGAGVLGFHRGLREGRCFLSGRGGAKWLSDLSRVSQSDPLRATGSGAPGLPGEGLPCRPRGFSLVQSRRWAGETRGPTRGTSWFAGGKCPSP

Conservation Score

0.042

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.059369

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9981

PhyloCSF Frame 3

0

CNTI Score

-0.308290785