McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF517-2:6

Chromosome

chr8

Gene Name

lnc-ZNF517-2

Start

144700683

CPC Label

noncoding

End

144708055

Cancer

OV

Strand

+

Peptide

SFSQPSHVIHNQR

Modified Peptide

n[145]SFSQPSHVIHNQR

Peptide Length

13

ORF Length

60

Open Reading Frame (ORF)

LIHTGEKPYKCIECGKAFNPKANPMQYQRIHTGEKLFECQECGKSFSQPSHVIHNQRKHA

Conservation Score

1

PhyloCSF Frame 1

-5.215

No. of Spectra

4

CPC Coding Probability

0.0464637

PhyloCSF Frame 2 

-3.26

CNTI Index

noncoding

Max Probability

0.8932

PhyloCSF Frame 3

-4.93

CNTI Score

-0.379866765