McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF513-1:2

Chromosome

chr2

Gene Name

lnc-ZNF513-1

Start

27392783

CPC Label

coding

End

27393367

Cancer

LUAD

Strand

-

Peptide

IVHFALHLEK

Modified Peptide

n[230]IVHFALHLEK

Peptide Length

10

ORF Length

104

Open Reading Frame (ORF)

LCGENAMGERAECDGLHLEKIVHFALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNMHEMGAPESGVAEYLFDKHTLGDSDNES

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.594657

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9316

PhyloCSF Frame 3

0

CNTI Score

0.688821351