McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF492-7:1

Chromosome

chr19

Gene Name

lnc-ZNF492-7

Start

22596275

CPC Label

noncoding

End

22601451

Cancer

PRAD

Strand

+

Peptide

KKPDEQIGSSK

Modified Peptide

‚Äč

Peptide Length

11

ORF Length

37

Open Reading Frame (ORF)

LPCRKKPDEQIGSSKEKVERLSVEEQPWCSYRSEKEN

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.131265

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0687

PhyloCSF Frame 3

0

CNTI Score

-0.310225082