McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF487-4:1

Chromosome

chr10

Gene Name

lnc-ZNF487-4

Start

43408933

CPC Label

noncoding

End

43416968

Cancer

LUAD

Strand

+

Peptide

LSIALSFRR

Modified Peptide

n[230]LSIALSFRR

Peptide Length

9

ORF Length

76

Open Reading Frame (ORF)

LMYCRANNCNHFILVDLLHEEMMSRHSSQVKLNIVTIVIISRLSIALSFRRECSGTITAHCSLDLLGSSDPPASTS

Conservation Score

0.045

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0528562

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3042

PhyloCSF Frame 3

0

CNTI Score

-0.271895822