McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF485-8:1

Chromosome

chr10

Gene Name

lnc-ZNF485-8

Start

43732333

CPC Label

noncoding

End

43732584

Cancer

OSCC

Strand

+

Peptide

GLQEELFDFLHAR

Modified Peptide

n[145]GLQEELFDFLHAR

Peptide Length

13

ORF Length

44

Open Reading Frame (ORF)

LEKCVKAWKQLELCDKRVILSITYRRGLQEELFDFLHARDHCFA

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.00677216

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9994

PhyloCSF Frame 3

0

CNTI Score

-0.408157546