McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF485-68:5

Chromosome

chr10

Gene Name

lnc-ZNF485-68

Start

43845305

CPC Label

coding

End

43877428

Cancer

OV

Strand

+

Peptide

ADGSPEIR

Modified Peptide

n[145]ADGSPEIR

Peptide Length

8

ORF Length

45

Open Reading Frame (ORF)

LDLWSEMAESQGQERWLMPVIPALWEAKADGSPEIRSSRPAWPTK

Conservation Score

0.779

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.726064

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9118

PhyloCSF Frame 3

0

CNTI Score

-0.346242939