McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF485-68:26

Chromosome

chr10

Gene Name

lnc-ZNF485-68

Start

43943236

CPC Label

noncoding

End

43983964

Cancer

OV

Strand

+

Peptide

GGLTESLTPER

Modified Peptide

n[145]GGLTESLTPER

Peptide Length

11

ORF Length

149

Open Reading Frame (ORF)

LRKRAEDGRILFREMGGEREERGGLTESLTPERERESWEGVRWTPWGFQEHQKEDSPVPGAGPWSPSHALVSGSRPWAAWPQSQCSLGFPAAAGPGSSILSVVGVLRCILSASTDVTRESQRKAGRWLRSISVGCPQPSEKASHSKVPC

Conservation Score

0.128

PhyloCSF Frame 1

-3.792

No. of Spectra

2

CPC Coding Probability

0.304158

PhyloCSF Frame 2 

-2.929

CNTI Index

noncoding

Max Probability

0.5353

PhyloCSF Frame 3

-4.779

CNTI Score

-0.322041254