McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF485-68:25

Chromosome

chr10

Gene Name

lnc-ZNF485-68

Start

43939002

CPC Label

noncoding

End

43944466

Cancer

PRAD

Strand

+

Peptide

ISLSQLTWGSFIAHAVK

Modified Peptide

‚Äč

Peptide Length

17

ORF Length

50

Open Reading Frame (ORF)

LQWTKISLSQLTWGSFIAHAVKAAVWRWGHRAGSMDGERILNNFDSAGFS

Conservation Score

0.256

PhyloCSF Frame 1

-3.579

No. of Spectra

4

CPC Coding Probability

0.326476

PhyloCSF Frame 2 

-5.103

CNTI Index

noncoding

Max Probability

0.7887

PhyloCSF Frame 3

-5.454

CNTI Score

-0.315641828