McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF485-68:20

Chromosome

chr10

Gene Name

lnc-ZNF485-68

Start

43909308

CPC Label

noncoding

End

43914412

Cancer

PRAD

Strand

+

Peptide

SSISGVISISNR

Modified Peptide

‚Äč

Peptide Length

12

ORF Length

51

Open Reading Frame (ORF)

LTPKHWFIIQLAIVEPQPMVEPKSSISGVISISNRRRVTFTDSYSPFGFQA

Conservation Score

0.006

PhyloCSF Frame 1

-5.269

No. of Spectra

1

CPC Coding Probability

0.0153642

PhyloCSF Frame 2 

-5.057

CNTI Index

noncoding

Max Probability

0.7986

PhyloCSF Frame 3

-5.844

CNTI Score

-0.359526139