McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF479-6:1

Chromosome

chr7

Gene Name

lnc-ZNF479-6

Start

56638942

CPC Label

coding

End

56650696

Cancer

CCRC

Strand

-

Peptide

YNGLHQCLSTTR

Modified Peptide

n[230]YNGLHQCLSTTR

Peptide Length

12

ORF Length

355

Open Reading Frame (ORF)

LTFRDVAVEFSPEEWECLDSAQQRLYRDVMLENYRNLVSLGLAIFKPDLMTCLEQRKEPWNVKRQEAVAKHPSPCCFHFTAEVLPEHDIKDSFQKVILRKYGSSDLNTLHLKKDYQSVGNCKGQKSRYNGLHQCLSTTRSKTSQCNKCGKAFGLCSIFTEHKEIFSKEKCYKCEECGKDCRLFSDFTLQKRIHTAERCYKCEDCAKVFKKFSNLTEHNRVHPGEKPYKCEECGKTFTCSSTLIKHKRNHSGDRPGKCEECNKAYRWFSHLAKHKRIHTGEKSYKCNECGKAFTWISVLSHHKKIHTREKPYICEGCGKAFTRSSTLISHKRIHMEERPYKCEECNKAYKWFSNLA

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.999991

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.7283

PhyloCSF Frame 3

0

CNTI Score

0.595573629