McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF479-23:1

Chromosome

chr7

Gene Name

lnc-ZNF479-23

Start

56809213

CPC Label

coding

End

56848800

Cancer

LUAD

Strand

-

Peptide

MLLPPSSLFRPR

Modified Peptide

n[230]MLLPPSSLFRPR

Peptide Length

12

ORF Length

119

Open Reading Frame (ORF)

MLLPPSSLFRPRTFSTQPLQTKLMTHNGLFRPIPYLTTVSADEATASQQPPQAQLHRYNGLFRPSSCLPAFSPGPELSQVDLTRPSSCHSLASQGPAFASRPPSKTQLLFYSGLWRPIF

Conservation Score

0.78

PhyloCSF Frame 1

0

No. of Spectra

13

CPC Coding Probability

0.669856

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9944

PhyloCSF Frame 3

0

CNTI Score

-0.18379087