McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF473-4:1

Chromosome

chr19

Gene Name

lnc-ZNF473-4

Start

49984650

CPC Label

noncoding

End

49987704

Cancer

PRAD

Strand

+

Peptide

ATTPGYFFCRDGVSPR

Modified Peptide

ATTPGYFFCRDGVSPR

Peptide Length

16

ORF Length

80

Open Reading Frame (ORF)

LGLQSRATTPGYFFCRDGVSPRCPGGSQTPGLKQSAHLSFQTAEITGVSHRTRSAAIPWAPTMCALCCIQRRMCVCVTGN

Conservation Score

0.024

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.114564

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.2801

PhyloCSF Frame 3

0

CNTI Score

-0.341042746