McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF449-144:1

Chromosome

chrX

Gene Name

lnc-ZNF449-144

Start

135327757

CPC Label

noncoding

End

135330743

Cancer

OSCC

Strand

+

Peptide

AMPGWSWPLPK

Modified Peptide

n[145]AMPGWSWPLPK

Peptide Length

11

ORF Length

109

Open Reading Frame (ORF)

LTSRSNHPVKATRELSTRLSWLCCLSEATWSLPVTDKGLSEVSPSTPAPNIRRKADEYLKSNMSPNNVLSFLLGRQLGRHRNDVDLTKWLWMLTRAMPGWSWPLPKKIT

Conservation Score

1

PhyloCSF Frame 1

-3.806

No. of Spectra

19

CPC Coding Probability

0.0269593

PhyloCSF Frame 2 

-2.37

CNTI Index

noncoding

Max Probability

0.9957

PhyloCSF Frame 3

7.033

CNTI Score

-0.378229477