McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF445-6:1

Chromosome

chr3

Gene Name

lnc-ZNF445-6

Start

44115819

CPC Label

noncoding

End

44117487

Cancer

OSCC

Strand

-

Peptide

EAAMGMEVCGPAGGLWLDLSMQGK

Modified Peptide

n[145]EAAMGMEVCGPAGGLWLDLSMQGK

Peptide Length

24

ORF Length

36

Open Reading Frame (ORF)

MHFGKEAAMGMEVCGPAGGLWLDLSMQGKQPKVVLP

Conservation Score

0.273

PhyloCSF Frame 1

-4.78

No. of Spectra

2

CPC Coding Probability

0.0407003

PhyloCSF Frame 2 

-5.184

CNTI Index

noncoding

Max Probability

0.9401

PhyloCSF Frame 3

-4.239

CNTI Score

-0.360657171