McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF445-5:3

Chromosome

chr3

Gene Name

lnc-ZNF445-5

Start

44326616

CPC Label

noncoding

End

44338333

Cancer

OV

Strand

-

Peptide

AVFLGQRR

Modified Peptide

n[145]AVFLGQRR

Peptide Length

8

ORF Length

61

Open Reading Frame (ORF)

MGPLDGIRCLLSPRHLQSIVTALTCIKFTRSERKAVFLGQRRTNQEREKGNSAVPGQPPPD

Conservation Score

0.823

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0702515

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8106

PhyloCSF Frame 3

0

CNTI Score

-0.32810688