McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF429-2:1

Chromosome

chr19

Gene Name

lnc-ZNF429-2

Start

21586793

CPC Label

noncoding

End

21722709

Cancer

OV

Strand

+

Peptide

LYDTPLFLSSTHR

Modified Peptide

n[145]LYDTPLFLSSTHR

Peptide Length

13

ORF Length

41

Open Reading Frame (ORF)

LPTGVIVTYKLGTAMRLYDTPLFLSSTHRGHCDIPLGSLPR

Conservation Score

0.373

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0477122

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9971

PhyloCSF Frame 3

0

CNTI Score

-0.36305392