McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF423-3:3

Chromosome

chr16

Gene Name

lnc-ZNF423-3

Start

50064284

CPC Label

noncoding

End

50066324

Cancer

OV

Strand

-

Peptide

SVAAAQLGR

Modified Peptide

n[145]SVAAAQLGR

Peptide Length

9

ORF Length

91

Open Reading Frame (ORF)

LGGQTTERGGQQQAVEAAAPLTRSVAAAQLGRLTAAAHMGKPCAGARRVVCRVGVGAGRGGGNWRTERAGVEEGIGGASFGKGAEPCGFTG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.104423

PhyloCSF Frame 2 

1.714

CNTI Index

coding

Max Probability

0.9677

PhyloCSF Frame 3

0

CNTI Score

0.698819463