McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF423-1:1

Chromosome

chr16

Gene Name

lnc-ZNF423-1

Start

49442909

CPC Label

noncoding

End

49454078

Cancer

OV

Strand

-

Peptide

FEEGVTK

Modified Peptide

n[145]FEEGVTK

Peptide Length

7

ORF Length

77

Open Reading Frame (ORF)

LALKRKKFLEDPPGARSLEVAALFSSHLGGQGSVSSQCSARGHGSRFEEGVTKGLFSDTRMAGNFLVRWSLNDTINE

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.0913133

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9973

PhyloCSF Frame 3

0

CNTI Score

-0.330601501