McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF415-4:8

Chromosome

chr19

Gene Name

lnc-ZNF415-4

Start

53076912

CPC Label

noncoding

End

53085395

Cancer

OV

Strand

-

Peptide

HATVILTR

Modified Peptide

n[145]HATVILTR

Peptide Length

8

ORF Length

95

Open Reading Frame (ORF)

LTCFRVRKQELTFLHPCWSMLGMKTGGSFNFLTSIKNATQGVSHRAWLLLISRYLLLGPQHFTNQPLVVFDSGFLQGRHATVILTRGSGDPSSLF

Conservation Score

0.232

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.116459

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.997

PhyloCSF Frame 3

0

CNTI Score

-0.44403245