McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF41-2:1

Chromosome

chrX

Gene Name

lnc-ZNF41-2

Start

47509786

CPC Label

coding

End

47513478

Cancer

BRCA-Luminal A

Strand

-

Peptide

TPPDALAR

Modified Peptide

n[145]TPPDALAR

Peptide Length

8

ORF Length

116

Open Reading Frame (ORF)

LSAPHAHLLAPRSVRHLELDLAALLPSRLCRGPSAARLHAPQAPGSRQEPPSPPAPARGVVPGSRTPPDALARGRSFLGEAACAYGPGDHRGGAGTQLLGHREPRGVVYGRGHLLH

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.992708

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.8511

PhyloCSF Frame 3

0

CNTI Score

0.7509824