McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF398-3:1

Chromosome

chr7

Gene Name

lnc-ZNF398-3

Start

149029135

CPC Label

noncoding

End

149032388

Cancer

OV

Strand

+

Peptide

KYQIGNLVVYIDLNK

Modified Peptide

n[145]KYQIGNLVVYIDLNK

Peptide Length

15

ORF Length

50

Open Reading Frame (ORF)

LSKLCLVLFSFLVIFCKRKYQIGNLVVYIDLNKSLRFSLLTTLEKKTRLR

Conservation Score

0.995

PhyloCSF Frame 1

-4.447

No. of Spectra

15

CPC Coding Probability

0.0422195

PhyloCSF Frame 2 

-4.144

CNTI Index

noncoding

Max Probability

0.9102

PhyloCSF Frame 3

-3.898

CNTI Score

-0.372323724