McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF391-5:2

Chromosome

chr6

Gene Name

lnc-ZNF391-5

Start

27472512

CPC Label

noncoding

End

27483984

Cancer

OSCC

Strand

+

Peptide

FENTGSYPLK

Modified Peptide

n[145]FENTGSYPLK

Peptide Length

10

ORF Length

116

Open Reading Frame (ORF)

MFYLLFSVLLFCRFENTGSYPLKLFSRLSNEWRPTFFFFFFFLRRNLALLLRLECNGAISARCNLHLPGSSDSPASASRVAGITGMHHHPRLIFVFLVETRGSPCWPGWSRTPDLK

Conservation Score

0.229

PhyloCSF Frame 1

0

No. of Spectra

29

CPC Coding Probability

0.12302

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.8973

PhyloCSF Frame 3

0

CNTI Score

0.619889648