McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF391-4:1

Chromosome

chr6

Gene Name

lnc-ZNF391-4

Start

27523075

CPC Label

coding

End

27524339

Cancer

LUAD

Strand

+

Peptide

SGSGNFGGGVGGGFGENDNFGR

Modified Peptide

n[230]SGSGNFGGGVGGGFGENDNFGR

Peptide Length

22

ORF Length

78

Open Reading Frame (ORF)

MERIVIQKYHTVNGHNCDFRSALSKQKMFSASSSQRDRSGSGNFGGGVGGGFGENDNFGRGGNFSGCAGFGGRSGGGR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

19

CPC Coding Probability

0.839145

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

0

CNTI Score

-0.316940834