McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF366-13:1

Chromosome

chr5

Gene Name

lnc-ZNF366-13

Start

72878867

CPC Label

noncoding

End

72879185

Cancer

HCC

Strand

-

Peptide

NNTETPGGK

Modified Peptide

NNTETPGGK

Peptide Length

9

ORF Length

54

Open Reading Frame (ORF)

LGKRCAYVHKTKNNTETPGGKLNKARVIWAHGNSGMVRAKFQSNLPAETIGHKI

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.047806

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6228

PhyloCSF Frame 3

0

CNTI Score

-0.452890228