McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF362-3:1

Chromosome

chr1

Gene Name

lnc-ZNF362-3

Start

33299373

CPC Label

noncoding

End

33300719

Cancer

EOGC

Strand

+

Peptide

GAVMGWVAGPGK

Modified Peptide

n[145]GAVM[147]GWVAGPGK

Peptide Length

12

ORF Length

179

Open Reading Frame (ORF)

LGITEQRGAAASGGRNERGGRSTGPKGAVMGWVAGPGKWGGDGLGKTWPSPAALKTTPVYLGAGQETFRLPLPPSQTVGRGMGREWAWIWDLPPEFPPDGGSAQGGVICLPCHGVGIPSRGPRPLSREGIPGEAGPRSRPCPQPPQTHPNLKAMRVGVYRNHVQSPEKPPTSPREKKEN

Conservation Score

1

PhyloCSF Frame 1

-0.463

No. of Spectra

1

CPC Coding Probability

0.331443

PhyloCSF Frame 2 

2.233

CNTI Index

noncoding

Max Probability

0.7278

PhyloCSF Frame 3

-1.202

CNTI Score

-0.368141007