McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF345-29:8

Chromosome

chr19

Gene Name

lnc-ZNF345-29

Start

36797517

CPC Label

noncoding

End

36813430

Cancer

LUAD

Strand

+

Peptide

LGGHEPGPYMMAK

Modified Peptide

n[43]LGGHEPGPYMMAK

Peptide Length

13

ORF Length

59

Open Reading Frame (ORF)

LGGHEPGPYMMAKLIDKHCMCSDCSPAQLFLHLSLLCPPYSLRLNNIKIISMNNPPMPS

Conservation Score

0.091

PhyloCSF Frame 1

0

No. of Spectra

28

CPC Coding Probability

0.140885

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9966

PhyloCSF Frame 3

0

CNTI Score

0.611018956