McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF345-29:3

Chromosome

chr19

Gene Name

lnc-ZNF345-29

Start

36797517

CPC Label

noncoding

End

36804688

Cancer

OV

Strand

+

Peptide

GVLAFSVRGWEIGHR

Modified Peptide

n[145]GVLAFSVRGWEIGHR

Peptide Length

15

ORF Length

63

Open Reading Frame (ORF)

LFGQAPAGHGTPKGHRRGVLAFSVRGWEIGHRYGGNWDSGCVPALPHRSTALVGARIGADIIS

Conservation Score

0.019

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.180105

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8671

PhyloCSF Frame 3

0

CNTI Score

-0.338008305