McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF33B-6:2

Chromosome

chr10

Gene Name

lnc-ZNF33B-6

Start

42409726

CPC Label

coding

End

42454714

Cancer

OSCC

Strand

-

Peptide

MHIDLWAYLMNSYTHLHEK

Modified Peptide

n[145]M[147]HIDLWAYLM[147]NSYTHLHEK

Peptide Length

19

ORF Length

33

Open Reading Frame (ORF)

MHIDLWAYLMNSYTHLHEKRFWRNILSMILNTN

Conservation Score

1

PhyloCSF Frame 1

-3.807

No. of Spectra

126

CPC Coding Probability

0.988771

PhyloCSF Frame 2 

-4.762

CNTI Index

noncoding

Max Probability

0.9686

PhyloCSF Frame 3

6.769

CNTI Score

-0.303134518