McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF33B-5:1

Chromosome

chr10

Gene Name

lnc-ZNF33B-5

Start

42779291

CPC Label

noncoding

End

42782505

Cancer

CCRC

Strand

-

Peptide

MLGFVSR

Modified Peptide

n[230]MLGFVSR

Peptide Length

7

ORF Length

59

Open Reading Frame (ORF)

MLGFVSREQWRDFVGESSLCSWFSYAPWPGSCRWVTSPETQWPVPSRSHSPHQLQAVLL

Conservation Score

0.09

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0499875

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9994

PhyloCSF Frame 3

0

CNTI Score

-0.35527557