McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF33A-2:7

Chromosome

chr10

Gene Name

lnc-ZNF33A-2

Start

37857748

CPC Label

coding

End

37888589

Cancer

CCRC

Strand

+

Peptide

LRQQYNVLIHLIK

Modified Peptide

n[230]LRQQYNVLIHLIK

Peptide Length

13

ORF Length

60

Open Reading Frame (ORF)

MLRQQYNVLIHLIKCILGCQAEKRIGRENKNHSKENKLGPGTVAHTCNPRTLGGQGQWIT

Conservation Score

0.023

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.933589

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9623

PhyloCSF Frame 3

0

CNTI Score

0.676543788