McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF326-6:2

Chromosome

chr1

Gene Name

lnc-ZNF326-6

Start

90718185

CPC Label

noncoding

End

90719710

Cancer

OV

Strand

+

Peptide

DTAGSASTRRSR

Modified Peptide

n[145]DTAGSASTRRSR

Peptide Length

12

ORF Length

161

Open Reading Frame (ORF)

LKESTEKCVTSGAGALHKRAGRLWALISRPTNPGARAQPGGRRIPERDTAGSASTRRSRGGRGLRLQAGEPAWSPAGKNAWPDAFSRTGELMPEAFSGGEGSHGSLRCRAGAGLRTHSGWSAARAPAAPRGSPSTSVPRPLSASAHLERKQSLRIHLGPGA

Conservation Score

1

PhyloCSF Frame 1

1.738

No. of Spectra

1

CPC Coding Probability

0.0470147

PhyloCSF Frame 2 

-1.52

CNTI Index

noncoding

Max Probability

0.4737

PhyloCSF Frame 3

-0.732

CNTI Score

-0.302134152