McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF322-2:3

Chromosome

chr6

Gene Name

lnc-ZNF322-2

Start

26471290

CPC Label

noncoding

End

26477149

Cancer

OV

Strand

-

Peptide

STFLLCHMRTHLK

Modified Peptide

n[145]STFLLCHMRTHLK

Peptide Length

13

ORF Length

68

Open Reading Frame (ORF)

LASQSAGMTGVSHRARPIFPVSWDKNQRSTFLLCHMRTHLKGCEQGCRLLPVTKLLVPWSYISQPPEC

Conservation Score

0.116

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.120961

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5644

PhyloCSF Frame 3

0

CNTI Score

-0.349496595