McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF322-2:1

Chromosome

chr6

Gene Name

lnc-ZNF322-2

Start

26471944

CPC Label

noncoding

End

26479123

Cancer

OV

Strand

-

Peptide

DLSETSLGSWR

Modified Peptide

n[145]DLSETSLGSWR

Peptide Length

11

ORF Length

57

Open Reading Frame (ORF)

LQARERDLSETSLGSWRRMRVSRHLGKPEFGKTAIFDLSGAARYWCESVRSFSLADE

Conservation Score

0.996

PhyloCSF Frame 1

-4.194

No. of Spectra

1

CPC Coding Probability

0.144697

PhyloCSF Frame 2 

-2.141

CNTI Index

noncoding

Max Probability

0.5399

PhyloCSF Frame 3

-3.831

CNTI Score

-0.349496595