McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF32-4:1

Chromosome

chr10

Gene Name

lnc-ZNF32-4

Start

43913898

CPC Label

noncoding

End

43914506

Cancer

OSCC

Strand

-

Peptide

EDLHLYLQNVLHCTGMK

Modified Peptide

n[145]EDLHLYLQNVLHCTGMK

Peptide Length

17

ORF Length

54

Open Reading Frame (ORF)

LVPSRGRSLNHARSFIQKEDLHLYLQNVLHCTGMKMVMITMVRAQAQALPCCVP

Conservation Score

0.945

PhyloCSF Frame 1

-4.899

No. of Spectra

6

CPC Coding Probability

0.0595662

PhyloCSF Frame 2 

-4.036

CNTI Index

noncoding

Max Probability

0.9958

PhyloCSF Frame 3

-4.786

CNTI Score

-0.377848307