McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF32-1:1

Chromosome

chr10

Gene Name

lnc-ZNF32-1

Start

43630881

CPC Label

noncoding

End

43631564

Cancer

OV

Strand

-

Peptide

MNQSIGK

Modified Peptide

n[145]M[147]NQSIGK

Peptide Length

7

ORF Length

50

Open Reading Frame (ORF)

MNQSIGKRFQQLKLLPICSHTVRFSGQSRLALLLNPDSHIRDQREQLHAS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

19

CPC Coding Probability

0.0455078

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9579

PhyloCSF Frame 3

0

CNTI Score

-0.420023665