McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF316-2:1

Chromosome

chr7

Gene Name

lnc-ZNF316-2

Start

6654863

CPC Label

noncoding

End

6656432

Cancer

OSCC

Strand

+

Peptide

AELQWENLK

Modified Peptide

n[145]AELQWENLK

Peptide Length

9

ORF Length

222

Open Reading Frame (ORF)

LRAARGGLVGFQRAELQWENLKLVVCGYLFPLLVWPEESRRRKSQIPNLRPGRRVAGVDRVLREFEALFSSRLLFSTHTCTEVTPAPSAPVRFWSLLVLSVLGTFVSLSRRWQTQTSTGARGPRSPEPQLSLPWAAPLREQADAPFSEPSAHLERLRLVEGSFPTSHNQGPRTLAGPFNSASVITLEQVVFLFRVPFHKLVSGGTRGLAACTVAVHLGGVWT

Conservation Score

0.742

PhyloCSF Frame 1

-3.563

No. of Spectra

3

CPC Coding Probability

0.0383686

PhyloCSF Frame 2 

-2.357

CNTI Index

noncoding

Max Probability

0.9718

PhyloCSF Frame 3

-3.251

CNTI Score

-0.300711363