McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF296-7:2

Chromosome

chr19

Gene Name

lnc-ZNF296-7

Start

44881088

CPC Label

noncoding

End

44890922

Cancer

PRAD

Strand

-

Peptide

LECSGMITTNCSPNLLGSSDPPTSPSGVAGTTGMCR

Modified Peptide

LECSGMITTNCSPNLLGSSDPPTSPSGVAGTTGM[147]CR

Peptide Length

36

ORF Length

65

Open Reading Frame (ORF)

LSPRLECSGMITTNCSPNLLGSSDPPTSPSGVAGTTGMCRQAQLFFFFFEFFCRDGVLPCCPGWS

Conservation Score

0.065

PhyloCSF Frame 1

0

No. of Spectra

21

CPC Coding Probability

0.0355852

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7795

PhyloCSF Frame 3

0

CNTI Score

-0.289570998