McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF286A-9:1

Chromosome

chr17

Gene Name

lnc-ZNF286A-9

Start

15506865

CPC Label

noncoding

End

15507354

Cancer

LUAD

Strand

+

Peptide

ISFELFANK

Modified Peptide

n[230]ISFELFANK

Peptide Length

9

ORF Length

82

Open Reading Frame (ORF)

MFFNIAINGEPLGRISFELFANKIPKTAENFHALSTGEKGFGYKGSCFHRIIPEFMCQGGDFTCHNGTGASTGRNLMSRTSP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0591577

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8442

PhyloCSF Frame 3

0

CNTI Score

-0.331377445