McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF284-1:1

Chromosome

chr19

Gene Name

lnc-ZNF284-1

Start

44094389

CPC Label

noncoding

End

44095941

Cancer

CCRC

Strand

+

Peptide

YNVGVLISLGFPLLFFK

Modified Peptide

YNVGVLISLGFPLLFFK

Peptide Length

17

ORF Length

35

Open Reading Frame (ORF)

LHPTRVATSSRYNVGVLISLGFPLLFFKMGTLGPS

Conservation Score

0.002

PhyloCSF Frame 1

-4.474

No. of Spectra

73

CPC Coding Probability

0.0247896

PhyloCSF Frame 2 

-5.443

CNTI Index

noncoding

Max Probability

0.9943

PhyloCSF Frame 3

-5.658

CNTI Score

-0.351129767