McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF280D-3:4

Chromosome

chr15

Gene Name

lnc-ZNF280D-3

Start

56859667

CPC Label

coding

End

56917648

Cancer

OV

Strand

-

Peptide

LISCLGYIVNNAAMNMGVPISL

Modified Peptide

n[145]LISCLGYIVNNAAMNM[147]GVPISL

Peptide Length

22

ORF Length

119

Open Reading Frame (ORF)

LRRSLALLPRLECRGTISAHCNLRLPGSSNSPTSASGLAGITGACHHARLIFVSLVETRFRHVGQACLELLTSSDLPASASQNAGITGVSHHAWLPRLISCLGYIVNNAAMNMGVPISL

Conservation Score

0.209

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.773683

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9313

PhyloCSF Frame 3

0

CNTI Score

-0.349508163