McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF275-4:1

Chromosome

chrX

Gene Name

lnc-ZNF275-4

Start

153423751

CPC Label

noncoding

End

153426476

Cancer

OV

Strand

+

Peptide

DAGHLHCDFGVPGK

Modified Peptide

n[145]DAGHLHCDFGVPGK

Peptide Length

14

ORF Length

43

Open Reading Frame (ORF)

LSRYWQDKVQEFSAESGVARRDAGHLHCDFGVPGKVPGSPVLT

Conservation Score

0.029

PhyloCSF Frame 1

-3.089

No. of Spectra

1

CPC Coding Probability

0.145288

PhyloCSF Frame 2 

-5.59

CNTI Index

noncoding

Max Probability

0.7076

PhyloCSF Frame 3

-4.172

CNTI Score

-0.304928023