McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF273-4:3

Chromosome

chr7

Gene Name

lnc-ZNF273-4

Start

65038361

CPC Label

noncoding

End

65074708

Cancer

HCC

Strand

+

Peptide

ALHFLEEVK

Modified Peptide

n[230]ALHFLEEVK

Peptide Length

9

ORF Length

141

Open Reading Frame (ORF)

LRPGALGEVLRRPCLQQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGFEAVKEKALHFLEEVKVSREMDKETLKDVARASLCTKVHAELADVLTEAVVGSILAIKRKDEPIDLFMIL

Conservation Score

1

PhyloCSF Frame 1

4.547

No. of Spectra

1

CPC Coding Probability

0.0654206

PhyloCSF Frame 2 

3.622

CNTI Index

coding

Max Probability

0.459

PhyloCSF Frame 3

7.413

CNTI Score

0.688476683