McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF267-4:1

Chromosome

chr16

Gene Name

lnc-ZNF267-4

Start

31961571

CPC Label

noncoding

End

31962422

Cancer

BRCA-Luminal B

Strand

+

Peptide

LSCAASGFTFSNSDMNWVL

Modified Peptide

n[145]LSCAASGFTFSNSDMNWVL

Peptide Length

19

ORF Length

35

Open Reading Frame (ORF)

LVESGGGLVQPGGSLRLSCAASGFTFSNSDMNWVL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.011227

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9027

PhyloCSF Frame 3

0

CNTI Score

-0.33826993