McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF266-1:6

Chromosome

chr19

Gene Name

lnc-ZNF266-1

Start

9376799

CPC Label

noncoding

End

9407024

Cancer

OV

Strand

-

Peptide

SIHGDITFK

Modified Peptide

n[145]SIHGDITFK

Peptide Length

9

ORF Length

47

Open Reading Frame (ORF)

MGGILVRKDCGGWEIRQYYLAKSIHGDITFKEELKLLSRRPNERMND

Conservation Score

0.282

PhyloCSF Frame 1

-3.481

No. of Spectra

5

CPC Coding Probability

0.279111

PhyloCSF Frame 2 

-4.922

CNTI Index

noncoding

Max Probability

0.8025

PhyloCSF Frame 3

-4.018

CNTI Score

-0.363163743